General Information

  • ID:  hor006221
  • Uniprot ID:  P51454
  • Protein name:  Relaxin B chain
  • Gene name:  RNL1
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed in the corpus luteum of pregnancy but not in the placenta.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DSWMDEVIKLCGRELVRAQIAICGMSTWS
  • Length:  29
  • Propeptide:  SRAVADSWMDEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPEPQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRQPYVALFEKCCLIGCTKRSLANYC
  • Signal peptide:  SRAVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:  H2Q7E1, H2R4E6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51454-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006221_AF2.pdbhor006221_ESM.pdb

Physical Information

Mass: 379849 Formula: C142H229N39O43S4
Absent amino acids: FHNPY Common amino acids: IS
pI: 4.54 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: 20 Boman Index: -3466
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 94.14
Instability Index: 2857.59 Extinction Coefficient cystines: 11125
Absorbance 280nm: 397.32

Literature

  • PubMed ID:  8182365
  • Title:  Characterization of two relaxin genes in the chimpanzee.